Anti DNASE1L1 pAb (ATL-HPA072635)

Atlas Antibodies

Catalog No: ATL-HPA072635-25

• 

Product Description

Protein Description: deoxyribonuclease I-like 1
Gene Name: DNASE1L1
Alternative Gene Name: DNAS1L1, DNASEX, DNL1L, XIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019088: 77%, ENSRNOG00000055641: 75%
Entrez Gene ID: 1774
Uniprot ID: P49184
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFHWVIADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDH
• Gene Sequence: GFHWVIADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDH
• Gene ID - Mouse: ENSMUSG00000019088
• Gene ID - Rat: ENSRNOG00000055641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.