Protein Description: deoxyribonuclease I-like 1
Gene Name: DNASE1L1
Alternative Gene Name: DNAS1L1, DNASEX, DNL1L, XIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019088: 77%, ENSRNOG00000055641: 75%
Entrez Gene ID: 1774
Uniprot ID: P49184
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNASE1L1
Alternative Gene Name: DNAS1L1, DNASEX, DNL1L, XIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019088: 77%, ENSRNOG00000055641: 75%
Entrez Gene ID: 1774
Uniprot ID: P49184
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GFHWVIADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDH |
| Documents & Links for Anti DNASE1L1 pAb (ATL-HPA072635) | |
| Datasheet | Anti DNASE1L1 pAb (ATL-HPA072635) Datasheet (External Link) |
| Vendor Page | Anti DNASE1L1 pAb (ATL-HPA072635) at Atlas |
| Documents & Links for Anti DNASE1L1 pAb (ATL-HPA072635) | |
| Datasheet | Anti DNASE1L1 pAb (ATL-HPA072635) Datasheet (External Link) |
| Vendor Page | Anti DNASE1L1 pAb (ATL-HPA072635) |