Anti DNAL1 pAb (ATL-HPA060974)

Atlas Antibodies

Catalog No: ATL-HPA060974-25

• 

Product Description

Protein Description: dynein axonemal light chain 1
Gene Name: DNAL1
Alternative Gene Name: 1700010H15RiK, C14orf168, CILD16, MGC12435
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042523: 94%, ENSRNOG00000042333: 94%
Entrez Gene ID: 83544
Uniprot ID: Q4LDG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDE
• Gene Sequence: NFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDE
• Gene ID - Mouse: ENSMUSG00000042523
• Gene ID - Rat: ENSRNOG00000042333
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.