Anti DNAJC13 pAb (ATL-HPA036924)

Atlas Antibodies

Catalog No: ATL-HPA036924-25

• 

Product Description

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 13
Gene Name: DNAJC13
Alternative Gene Name: KIAA0678, RME8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032560: 97%, ENSRNOG00000011491: 97%
Entrez Gene ID: 23317
Uniprot ID: O75165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRDKVSTTVREMM
• Gene Sequence: QVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRDKVSTTVREMM
• Gene ID - Mouse: ENSMUSG00000032560
• Gene ID - Rat: ENSRNOG00000011491
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.