Description
Product Description
Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 13
Gene Name: DNAJC13
Alternative Gene Name: KIAA0678, RME8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032560: 97%, ENSRNOG00000011491: 97%
Entrez Gene ID: 23317
Uniprot ID: O75165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNAJC13
Alternative Gene Name: KIAA0678, RME8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032560: 97%, ENSRNOG00000011491: 97%
Entrez Gene ID: 23317
Uniprot ID: O75165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRDKVSTTVREMM |
Gene Sequence | QVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRDKVSTTVREMM |
Gene ID - Mouse | ENSMUSG00000032560 |
Gene ID - Rat | ENSRNOG00000011491 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DNAJC13 pAb (ATL-HPA036924) | |
Datasheet | Anti DNAJC13 pAb (ATL-HPA036924) Datasheet (External Link) |
Vendor Page | Anti DNAJC13 pAb (ATL-HPA036924) at Atlas Antibodies |
Documents & Links for Anti DNAJC13 pAb (ATL-HPA036924) | |
Datasheet | Anti DNAJC13 pAb (ATL-HPA036924) Datasheet (External Link) |
Vendor Page | Anti DNAJC13 pAb (ATL-HPA036924) |