Anti DNAJB13 pAb (ATL-HPA061330)

Atlas Antibodies

Catalog No: ATL-HPA061330-25

• 

Product Description

Protein Description: DnaJ heat shock protein family (Hsp40) member B13
Gene Name: DNAJB13
Alternative Gene Name: RSPH16A, TSARG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030708: 84%, ENSRNOG00000017975: 86%
Entrez Gene ID: 374407
Uniprot ID: P59910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE
• Gene Sequence: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE
• Gene ID - Mouse: ENSMUSG00000030708
• Gene ID - Rat: ENSRNOG00000017975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.