Description
Product Description
Protein Description: dynein axonemal heavy chain 17
Gene Name: DNAH17
Alternative Gene Name: DNAHL1, DNEL2, FLJ40457
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033987: 78%, ENSRNOG00000003028: 81%
Entrez Gene ID: 8632
Uniprot ID: Q9UFH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNAH17
Alternative Gene Name: DNAHL1, DNEL2, FLJ40457
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033987: 78%, ENSRNOG00000003028: 81%
Entrez Gene ID: 8632
Uniprot ID: Q9UFH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMD |
Gene Sequence | PWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMD |
Gene ID - Mouse | ENSMUSG00000033987 |
Gene ID - Rat | ENSRNOG00000003028 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DNAH17 pAb (ATL-HPA076261 w/enhanced validation) | |
Datasheet | Anti DNAH17 pAb (ATL-HPA076261 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNAH17 pAb (ATL-HPA076261 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DNAH17 pAb (ATL-HPA076261 w/enhanced validation) | |
Datasheet | Anti DNAH17 pAb (ATL-HPA076261 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNAH17 pAb (ATL-HPA076261 w/enhanced validation) |