Description
Product Description
Protein Description: dynein, axonemal, heavy chain 12
Gene Name: DNAH12
Alternative Gene Name: DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021879: 87%, ENSRNOG00000059865: 84%
Entrez Gene ID: 201625
Uniprot ID: Q6ZR08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DNAH12
Alternative Gene Name: DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021879: 87%, ENSRNOG00000059865: 84%
Entrez Gene ID: 201625
Uniprot ID: Q6ZR08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKII |
Gene Sequence | LLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKII |
Gene ID - Mouse | ENSMUSG00000021879 |
Gene ID - Rat | ENSRNOG00000059865 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation) | |
Datasheet | Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation) | |
Datasheet | Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation) |