Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation)

Catalog No:
ATL-HPA058203-25
$303.00

Description

Product Description

Protein Description: dynein, axonemal, heavy chain 12
Gene Name: DNAH12
Alternative Gene Name: DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021879: 87%, ENSRNOG00000059865: 84%
Entrez Gene ID: 201625
Uniprot ID: Q6ZR08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKII
Gene Sequence LLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKII
Gene ID - Mouse ENSMUSG00000021879
Gene ID - Rat ENSRNOG00000059865
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation)
Datasheet Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation)

Product Description

Protein Description: dynein, axonemal, heavy chain 12
Gene Name: DNAH12
Alternative Gene Name: DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021879: 87%, ENSRNOG00000059865: 84%
Entrez Gene ID: 201625
Uniprot ID: Q6ZR08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKII
Gene Sequence LLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKII
Gene ID - Mouse ENSMUSG00000021879
Gene ID - Rat ENSRNOG00000059865
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation)
Datasheet Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNAH12 pAb (ATL-HPA058203 w/enhanced validation)