Protein Description: dystrophia myotonica, WD repeat containing
Gene Name: DMWD
Alternative Gene Name: D19S593E, DMR-N9, gene59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030410: 94%, ENSRNOG00000014984: 96%
Entrez Gene ID: 1762
Uniprot ID: Q09019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DMWD
Alternative Gene Name: D19S593E, DMR-N9, gene59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030410: 94%, ENSRNOG00000014984: 96%
Entrez Gene ID: 1762
Uniprot ID: Q09019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TYLKWLPESESLFLASHASGHLYLYNVSHPCASAPPQYSLLKQGEGFSVYA |
| Documents & Links for Anti DMWD pAb (ATL-HPA069843) | |
| Datasheet | Anti DMWD pAb (ATL-HPA069843) Datasheet (External Link) |
| Vendor Page | Anti DMWD pAb (ATL-HPA069843) at Atlas |
| Documents & Links for Anti DMWD pAb (ATL-HPA069843) | |
| Datasheet | Anti DMWD pAb (ATL-HPA069843) Datasheet (External Link) |
| Vendor Page | Anti DMWD pAb (ATL-HPA069843) |