Protein Description: DMRT-like family A2
Gene Name: DMRTA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047143: 96%, ENSRNOG00000017190: 30%
Entrez Gene ID: 63950
Uniprot ID: Q96SC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DMRTA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047143: 96%, ENSRNOG00000017190: 30%
Entrez Gene ID: 63950
Uniprot ID: Q96SC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VPTLGFRPPMDYAFSDLMRDRSAAAAAAVHKEPTYGGGLYGPMVNGAPEKQ |
| Documents & Links for Anti DMRTA2 pAb (ATL-HPA062958) | |
| Datasheet | Anti DMRTA2 pAb (ATL-HPA062958) Datasheet (External Link) |
| Vendor Page | Anti DMRTA2 pAb (ATL-HPA062958) at Atlas |
| Documents & Links for Anti DMRTA2 pAb (ATL-HPA062958) | |
| Datasheet | Anti DMRTA2 pAb (ATL-HPA062958) Datasheet (External Link) |
| Vendor Page | Anti DMRTA2 pAb (ATL-HPA062958) |