Anti DMRTA2 pAb (ATL-HPA062958)

Catalog No:
ATL-HPA062958-25
$447.00

Description

Product Description

Protein Description: DMRT-like family A2
Gene Name: DMRTA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047143: 96%, ENSRNOG00000017190: 30%
Entrez Gene ID: 63950
Uniprot ID: Q96SC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPTLGFRPPMDYAFSDLMRDRSAAAAAAVHKEPTYGGGLYGPMVNGAPEKQ
Gene Sequence VPTLGFRPPMDYAFSDLMRDRSAAAAAAVHKEPTYGGGLYGPMVNGAPEKQ
Gene ID - Mouse ENSMUSG00000047143
Gene ID - Rat ENSRNOG00000017190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DMRTA2 pAb (ATL-HPA062958)
Datasheet Anti DMRTA2 pAb (ATL-HPA062958) Datasheet (External Link)
Vendor Page Anti DMRTA2 pAb (ATL-HPA062958) at Atlas Antibodies

Documents & Links for Anti DMRTA2 pAb (ATL-HPA062958)
Datasheet Anti DMRTA2 pAb (ATL-HPA062958) Datasheet (External Link)
Vendor Page Anti DMRTA2 pAb (ATL-HPA062958)

Product Description

Protein Description: DMRT-like family A2
Gene Name: DMRTA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047143: 96%, ENSRNOG00000017190: 30%
Entrez Gene ID: 63950
Uniprot ID: Q96SC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPTLGFRPPMDYAFSDLMRDRSAAAAAAVHKEPTYGGGLYGPMVNGAPEKQ
Gene Sequence VPTLGFRPPMDYAFSDLMRDRSAAAAAAVHKEPTYGGGLYGPMVNGAPEKQ
Gene ID - Mouse ENSMUSG00000047143
Gene ID - Rat ENSRNOG00000017190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DMRTA2 pAb (ATL-HPA062958)
Datasheet Anti DMRTA2 pAb (ATL-HPA062958) Datasheet (External Link)
Vendor Page Anti DMRTA2 pAb (ATL-HPA062958) at Atlas Antibodies

Documents & Links for Anti DMRTA2 pAb (ATL-HPA062958)
Datasheet Anti DMRTA2 pAb (ATL-HPA062958) Datasheet (External Link)
Vendor Page Anti DMRTA2 pAb (ATL-HPA062958)