Protein Description: dimethylglycine dehydrogenase
Gene Name: DMGDH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042102: 92%, ENSRNOG00000023588: 90%
Entrez Gene ID: 29958
Uniprot ID: Q9UI17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DMGDH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042102: 92%, ENSRNOG00000023588: 90%
Entrez Gene ID: 29958
Uniprot ID: Q9UI17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AGARKCGALLKYPAPVTSLKARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVK |
| Documents & Links for Anti DMGDH pAb (ATL-HPA077849) | |
| Datasheet | Anti DMGDH pAb (ATL-HPA077849) Datasheet (External Link) |
| Vendor Page | Anti DMGDH pAb (ATL-HPA077849) at Atlas |
| Documents & Links for Anti DMGDH pAb (ATL-HPA077849) | |
| Datasheet | Anti DMGDH pAb (ATL-HPA077849) Datasheet (External Link) |
| Vendor Page | Anti DMGDH pAb (ATL-HPA077849) |