Anti DMGDH pAb (ATL-HPA077849)

Catalog No:
ATL-HPA077849-25
$447.00

Description

Product Description

Protein Description: dimethylglycine dehydrogenase
Gene Name: DMGDH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042102: 92%, ENSRNOG00000023588: 90%
Entrez Gene ID: 29958
Uniprot ID: Q9UI17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGARKCGALLKYPAPVTSLKARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVK
Gene Sequence AGARKCGALLKYPAPVTSLKARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVK
Gene ID - Mouse ENSMUSG00000042102
Gene ID - Rat ENSRNOG00000023588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DMGDH pAb (ATL-HPA077849)
Datasheet Anti DMGDH pAb (ATL-HPA077849) Datasheet (External Link)
Vendor Page Anti DMGDH pAb (ATL-HPA077849) at Atlas Antibodies

Documents & Links for Anti DMGDH pAb (ATL-HPA077849)
Datasheet Anti DMGDH pAb (ATL-HPA077849) Datasheet (External Link)
Vendor Page Anti DMGDH pAb (ATL-HPA077849)

Product Description

Protein Description: dimethylglycine dehydrogenase
Gene Name: DMGDH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042102: 92%, ENSRNOG00000023588: 90%
Entrez Gene ID: 29958
Uniprot ID: Q9UI17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGARKCGALLKYPAPVTSLKARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVK
Gene Sequence AGARKCGALLKYPAPVTSLKARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVK
Gene ID - Mouse ENSMUSG00000042102
Gene ID - Rat ENSRNOG00000023588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DMGDH pAb (ATL-HPA077849)
Datasheet Anti DMGDH pAb (ATL-HPA077849) Datasheet (External Link)
Vendor Page Anti DMGDH pAb (ATL-HPA077849) at Atlas Antibodies

Documents & Links for Anti DMGDH pAb (ATL-HPA077849)
Datasheet Anti DMGDH pAb (ATL-HPA077849) Datasheet (External Link)
Vendor Page Anti DMGDH pAb (ATL-HPA077849)