Protein Description: delta like non-canonical Notch ligand 2
Gene Name: DLK2
Alternative Gene Name: EGFL9, MGC2487
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047428: 89%, ENSRNOG00000018949: 87%
Entrez Gene ID: 65989
Uniprot ID: Q6UY11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DLK2
Alternative Gene Name: EGFL9, MGC2487
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047428: 89%, ENSRNOG00000018949: 87%
Entrez Gene ID: 65989
Uniprot ID: Q6UY11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PGPCCYPAPHYAPACQDQECQVSMLPAGLPLPRDLPPEPGKTTAL |
Documents & Links for Anti DLK2 pAb (ATL-HPA070955) | |
Datasheet | Anti DLK2 pAb (ATL-HPA070955) Datasheet (External Link) |
Vendor Page | Anti DLK2 pAb (ATL-HPA070955) at Atlas |
Documents & Links for Anti DLK2 pAb (ATL-HPA070955) | |
Datasheet | Anti DLK2 pAb (ATL-HPA070955) Datasheet (External Link) |
Vendor Page | Anti DLK2 pAb (ATL-HPA070955) |