Anti DLK2 pAb (ATL-HPA061223)

Atlas Antibodies

Catalog No: ATL-HPA061223-25

• 

Product Description

Protein Description: delta-like 2 homolog (Drosophila)
Gene Name: DLK2
Alternative Gene Name: EGFL9, MGC2487
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047428: 91%, ENSRNOG00000018949: 89%
Entrez Gene ID: 65989
Uniprot ID: Q6UY11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSC
• Gene Sequence: RNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSC
• Gene ID - Mouse: ENSMUSG00000047428
• Gene ID - Rat: ENSRNOG00000018949
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.