Protein Description: delta-like 1 homolog (Drosophila)
Gene Name: DLK1
Alternative Gene Name: Delta1, FA1, pG2, Pref-1, ZOG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098411: 83%, ENSRNOG00000019584: 83%
Entrez Gene ID: 8788
Uniprot ID: P80370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DLK1
Alternative Gene Name: Delta1, FA1, pG2, Pref-1, ZOG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098411: 83%, ENSRNOG00000019584: 83%
Entrez Gene ID: 8788
Uniprot ID: P80370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ |
Documents & Links for Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) | |
Datasheet | Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) at Atlas |
Documents & Links for Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) | |
Datasheet | Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) |