Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation)

Catalog No:
ATL-HPA062262-25
$395.00

Description

Product Description

Protein Description: delta-like 1 homolog (Drosophila)
Gene Name: DLK1
Alternative Gene Name: Delta1, FA1, pG2, Pref-1, ZOG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098411: 83%, ENSRNOG00000019584: 83%
Entrez Gene ID: 8788
Uniprot ID: P80370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Gene Sequence FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Gene ID - Mouse ENSMUSG00000098411
Gene ID - Rat ENSRNOG00000019584
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation)
Datasheet Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation)
Datasheet Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation)

Product Description

Protein Description: delta-like 1 homolog (Drosophila)
Gene Name: DLK1
Alternative Gene Name: Delta1, FA1, pG2, Pref-1, ZOG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098411: 83%, ENSRNOG00000019584: 83%
Entrez Gene ID: 8788
Uniprot ID: P80370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Gene Sequence FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Gene ID - Mouse ENSMUSG00000098411
Gene ID - Rat ENSRNOG00000019584
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation)
Datasheet Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation)
Datasheet Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation)