Protein Description: discs, large homolog 3 (Drosophila)
Gene Name: DLG3
Alternative Gene Name: KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000881: 99%, ENSRNOG00000002767: 99%
Entrez Gene ID: 1741
Uniprot ID: Q92796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DLG3
Alternative Gene Name: KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000881: 99%, ENSRNOG00000002767: 99%
Entrez Gene ID: 1741
Uniprot ID: Q92796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHK |
Documents & Links for Anti DLG3 pAb (ATL-HPA078130) | |
Datasheet | Anti DLG3 pAb (ATL-HPA078130) Datasheet (External Link) |
Vendor Page | Anti DLG3 pAb (ATL-HPA078130) at Atlas |
Documents & Links for Anti DLG3 pAb (ATL-HPA078130) | |
Datasheet | Anti DLG3 pAb (ATL-HPA078130) Datasheet (External Link) |
Vendor Page | Anti DLG3 pAb (ATL-HPA078130) |