Anti DLG3 pAb (ATL-HPA078130)

Catalog No:
ATL-HPA078130-25
$447.00

Description

Product Description

Protein Description: discs, large homolog 3 (Drosophila)
Gene Name: DLG3
Alternative Gene Name: KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000881: 99%, ENSRNOG00000002767: 99%
Entrez Gene ID: 1741
Uniprot ID: Q92796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHK
Gene Sequence HLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHK
Gene ID - Mouse ENSMUSG00000000881
Gene ID - Rat ENSRNOG00000002767
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DLG3 pAb (ATL-HPA078130)
Datasheet Anti DLG3 pAb (ATL-HPA078130) Datasheet (External Link)
Vendor Page Anti DLG3 pAb (ATL-HPA078130) at Atlas Antibodies

Documents & Links for Anti DLG3 pAb (ATL-HPA078130)
Datasheet Anti DLG3 pAb (ATL-HPA078130) Datasheet (External Link)
Vendor Page Anti DLG3 pAb (ATL-HPA078130)

Product Description

Protein Description: discs, large homolog 3 (Drosophila)
Gene Name: DLG3
Alternative Gene Name: KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000881: 99%, ENSRNOG00000002767: 99%
Entrez Gene ID: 1741
Uniprot ID: Q92796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHK
Gene Sequence HLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHK
Gene ID - Mouse ENSMUSG00000000881
Gene ID - Rat ENSRNOG00000002767
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DLG3 pAb (ATL-HPA078130)
Datasheet Anti DLG3 pAb (ATL-HPA078130) Datasheet (External Link)
Vendor Page Anti DLG3 pAb (ATL-HPA078130) at Atlas Antibodies

Documents & Links for Anti DLG3 pAb (ATL-HPA078130)
Datasheet Anti DLG3 pAb (ATL-HPA078130) Datasheet (External Link)
Vendor Page Anti DLG3 pAb (ATL-HPA078130)