Description
Product Description
Protein Description: disrupted in renal carcinoma 2
Gene Name: DIRC2
Alternative Gene Name: FLJ14784, RCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022848: 92%, ENSRNOG00000002240: 92%
Entrez Gene ID: 84925
Uniprot ID: Q96SL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DIRC2
Alternative Gene Name: FLJ14784, RCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022848: 92%, ENSRNOG00000002240: 92%
Entrez Gene ID: 84925
Uniprot ID: Q96SL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS |
Gene Sequence | IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS |
Gene ID - Mouse | ENSMUSG00000022848 |
Gene ID - Rat | ENSRNOG00000002240 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DIRC2 pAb (ATL-HPA072579) | |
Datasheet | Anti DIRC2 pAb (ATL-HPA072579) Datasheet (External Link) |
Vendor Page | Anti DIRC2 pAb (ATL-HPA072579) at Atlas Antibodies |
Documents & Links for Anti DIRC2 pAb (ATL-HPA072579) | |
Datasheet | Anti DIRC2 pAb (ATL-HPA072579) Datasheet (External Link) |
Vendor Page | Anti DIRC2 pAb (ATL-HPA072579) |