Anti DHX35 pAb (ATL-HPA062700)

Atlas Antibodies

Catalog No: ATL-HPA062700-25

• 

Product Description

Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 35
Gene Name: DHX35
Alternative Gene Name: C20orf15, DDX35, FLJ22759, KAIA0875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027655: 99%, ENSRNOG00000015928: 100%
Entrez Gene ID: 60625
Uniprot ID: Q9H5Z1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLRCIVSGFFANAARFHSTGAYRTIRDDHELHIHPASVLYAEKPPRWVIYNEVIQTSKYYMRDVTAIESAWLLELAPHFYQQGTHLSLKAKRAKVQ
• Gene Sequence: VLRCIVSGFFANAARFHSTGAYRTIRDDHELHIHPASVLYAEKPPRWVIYNEVIQTSKYYMRDVTAIESAWLLELAPHFYQQGTHLSLKAKRAKVQ
• Gene ID - Mouse: ENSMUSG00000027655
• Gene ID - Rat: ENSRNOG00000015928
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.