Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 33
Gene Name: DHX33
Alternative Gene Name: DDX33, DKFZp762F2011, FLJ21972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040620: 93%, ENSRNOG00000007054: 93%
Entrez Gene ID: 56919
Uniprot ID: Q9H6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DHX33
Alternative Gene Name: DDX33, DKFZp762F2011, FLJ21972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040620: 93%, ENSRNOG00000007054: 93%
Entrez Gene ID: 56919
Uniprot ID: Q9H6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGALEHKDDQLTLTPMGRKMAAFPLEPKFAKTILMS |
Documents & Links for Anti DHX33 pAb (ATL-HPA073875) | |
Datasheet | Anti DHX33 pAb (ATL-HPA073875) Datasheet (External Link) |
Vendor Page | Anti DHX33 pAb (ATL-HPA073875) at Atlas |
Documents & Links for Anti DHX33 pAb (ATL-HPA073875) | |
Datasheet | Anti DHX33 pAb (ATL-HPA073875) Datasheet (External Link) |
Vendor Page | Anti DHX33 pAb (ATL-HPA073875) |