Protein Description: dehydrogenase E1 and transketolase domain containing 1
Gene Name: DHTKD1
Alternative Gene Name: CMT2Q, DKFZP762M115, KIAA1630, MGC3090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025815: 84%, ENSRNOG00000062048: 89%
Entrez Gene ID: 55526
Uniprot ID: Q96HY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DHTKD1
Alternative Gene Name: CMT2Q, DKFZP762M115, KIAA1630, MGC3090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025815: 84%, ENSRNOG00000062048: 89%
Entrez Gene ID: 55526
Uniprot ID: Q96HY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLA |
| Documents & Links for Anti DHTKD1 pAb (ATL-HPA066098) | |
| Datasheet | Anti DHTKD1 pAb (ATL-HPA066098) Datasheet (External Link) |
| Vendor Page | Anti DHTKD1 pAb (ATL-HPA066098) at Atlas |
| Documents & Links for Anti DHTKD1 pAb (ATL-HPA066098) | |
| Datasheet | Anti DHTKD1 pAb (ATL-HPA066098) Datasheet (External Link) |
| Vendor Page | Anti DHTKD1 pAb (ATL-HPA066098) |