Description
Product Description
Protein Description: DGCR8, microprocessor complex subunit
Gene Name: DGCR8
Alternative Gene Name: C22orf12, DGCRK6, Gy1, pasha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022718: 95%, ENSRNOG00000001886: 93%
Entrez Gene ID: 54487
Uniprot ID: Q8WYQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DGCR8
Alternative Gene Name: C22orf12, DGCRK6, Gy1, pasha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022718: 95%, ENSRNOG00000001886: 93%
Entrez Gene ID: 54487
Uniprot ID: Q8WYQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDAL |
Gene Sequence | YGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDAL |
Gene ID - Mouse | ENSMUSG00000022718 |
Gene ID - Rat | ENSRNOG00000001886 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DGCR8 pAb (ATL-HPA079351) | |
Datasheet | Anti DGCR8 pAb (ATL-HPA079351) Datasheet (External Link) |
Vendor Page | Anti DGCR8 pAb (ATL-HPA079351) at Atlas Antibodies |
Documents & Links for Anti DGCR8 pAb (ATL-HPA079351) | |
Datasheet | Anti DGCR8 pAb (ATL-HPA079351) Datasheet (External Link) |
Vendor Page | Anti DGCR8 pAb (ATL-HPA079351) |