Protein Description: DGCR8, microprocessor complex subunit
Gene Name: DGCR8
Alternative Gene Name: C22orf12, DGCRK6, Gy1, pasha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022718: 100%, ENSRNOG00000001886: 100%
Entrez Gene ID: 54487
Uniprot ID: Q8WYQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DGCR8
Alternative Gene Name: C22orf12, DGCRK6, Gy1, pasha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022718: 100%, ENSRNOG00000001886: 100%
Entrez Gene ID: 54487
Uniprot ID: Q8WYQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPG |
| Documents & Links for Anti DGCR8 pAb (ATL-HPA076916) | |
| Datasheet | Anti DGCR8 pAb (ATL-HPA076916) Datasheet (External Link) |
| Vendor Page | Anti DGCR8 pAb (ATL-HPA076916) at Atlas |
| Documents & Links for Anti DGCR8 pAb (ATL-HPA076916) | |
| Datasheet | Anti DGCR8 pAb (ATL-HPA076916) Datasheet (External Link) |
| Vendor Page | Anti DGCR8 pAb (ATL-HPA076916) |