Description
Product Description
Protein Description: deoxyribose-phosphate aldolase (putative)
Gene Name: DERA
Alternative Gene Name: CGI-26, DEOC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030225: 92%, ENSRNOG00000007570: 91%
Entrez Gene ID: 51071
Uniprot ID: Q9Y315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DERA
Alternative Gene Name: CGI-26, DEOC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030225: 92%, ENSRNOG00000007570: 91%
Entrez Gene ID: 51071
Uniprot ID: Q9Y315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVAS |
Gene Sequence | ISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVAS |
Gene ID - Mouse | ENSMUSG00000030225 |
Gene ID - Rat | ENSRNOG00000007570 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DERA pAb (ATL-HPA055897) | |
Datasheet | Anti DERA pAb (ATL-HPA055897) Datasheet (External Link) |
Vendor Page | Anti DERA pAb (ATL-HPA055897) at Atlas Antibodies |
Documents & Links for Anti DERA pAb (ATL-HPA055897) | |
Datasheet | Anti DERA pAb (ATL-HPA055897) Datasheet (External Link) |
Vendor Page | Anti DERA pAb (ATL-HPA055897) |