Protein Description: DENN/MADD domain containing 6A
Gene Name: DENND6A
Alternative Gene Name: AFI1A, FAM116A, FLJ34969
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040818: 92%, ENSRNOG00000011636: 96%
Entrez Gene ID: 201627
Uniprot ID: Q8IWF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DENND6A
Alternative Gene Name: AFI1A, FAM116A, FLJ34969
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040818: 92%, ENSRNOG00000011636: 96%
Entrez Gene ID: 201627
Uniprot ID: Q8IWF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILL |
Documents & Links for Anti DENND6A pAb (ATL-HPA071711) | |
Datasheet | Anti DENND6A pAb (ATL-HPA071711) Datasheet (External Link) |
Vendor Page | Anti DENND6A pAb (ATL-HPA071711) at Atlas |
Documents & Links for Anti DENND6A pAb (ATL-HPA071711) | |
Datasheet | Anti DENND6A pAb (ATL-HPA071711) Datasheet (External Link) |
Vendor Page | Anti DENND6A pAb (ATL-HPA071711) |