Protein Description: DENN/MADD domain containing 6A
Gene Name: DENND6A
Alternative Gene Name: AFI1A, FAM116A, FLJ34969
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040818: 98%, ENSRNOG00000011636: 100%
Entrez Gene ID: 201627
Uniprot ID: Q8IWF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DENND6A
Alternative Gene Name: AFI1A, FAM116A, FLJ34969
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040818: 98%, ENSRNOG00000011636: 100%
Entrez Gene ID: 201627
Uniprot ID: Q8IWF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QVKVKKLKNLKTLDSKPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYF |
| Documents & Links for Anti DENND6A pAb (ATL-HPA069725) | |
| Datasheet | Anti DENND6A pAb (ATL-HPA069725) Datasheet (External Link) |
| Vendor Page | Anti DENND6A pAb (ATL-HPA069725) at Atlas |
| Documents & Links for Anti DENND6A pAb (ATL-HPA069725) | |
| Datasheet | Anti DENND6A pAb (ATL-HPA069725) Datasheet (External Link) |
| Vendor Page | Anti DENND6A pAb (ATL-HPA069725) |