Protein Description: DENN domain containing 4B
Gene Name: DENND4B
Alternative Gene Name: KIAA0476
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042404: 95%, ENSRNOG00000022373: 93%
Entrez Gene ID: 9909
Uniprot ID: O75064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DENND4B
Alternative Gene Name: KIAA0476
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042404: 95%, ENSRNOG00000022373: 93%
Entrez Gene ID: 9909
Uniprot ID: O75064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PSPWLTPDPASVQVRLLWDVLTPDPNSCPPLYVLWRVHSQIPQRVVWPGPVPASLSLALLESVLRHVGLNEVHKAVGLLLETLG |
| Documents & Links for Anti DENND4B pAb (ATL-HPA071133) | |
| Datasheet | Anti DENND4B pAb (ATL-HPA071133) Datasheet (External Link) |
| Vendor Page | Anti DENND4B pAb (ATL-HPA071133) at Atlas |
| Documents & Links for Anti DENND4B pAb (ATL-HPA071133) | |
| Datasheet | Anti DENND4B pAb (ATL-HPA071133) Datasheet (External Link) |
| Vendor Page | Anti DENND4B pAb (ATL-HPA071133) |