Protein Description: DENN/MADD domain containing 4A
Gene Name: DENND4A
Alternative Gene Name: IRLB, MYCPBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053641: 84%, ENSRNOG00000011739: 82%
Entrez Gene ID: 10260
Uniprot ID: Q7Z401
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DENND4A
Alternative Gene Name: IRLB, MYCPBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053641: 84%, ENSRNOG00000011739: 82%
Entrez Gene ID: 10260
Uniprot ID: Q7Z401
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGL |
Documents & Links for Anti DENND4A pAb (ATL-HPA065343) | |
Datasheet | Anti DENND4A pAb (ATL-HPA065343) Datasheet (External Link) |
Vendor Page | Anti DENND4A pAb (ATL-HPA065343) at Atlas |
Documents & Links for Anti DENND4A pAb (ATL-HPA065343) | |
Datasheet | Anti DENND4A pAb (ATL-HPA065343) Datasheet (External Link) |
Vendor Page | Anti DENND4A pAb (ATL-HPA065343) |