Protein Description: DEK proto-oncogene
Gene Name: DEK
Alternative Gene Name: D6S231E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021377: 92%, ENSRNOG00000016152: 91%
Entrez Gene ID: 7913
Uniprot ID: P35659
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DEK
Alternative Gene Name: D6S231E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021377: 92%, ENSRNOG00000016152: 91%
Entrez Gene ID: 7913
Uniprot ID: P35659
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEI |
| Documents & Links for Anti DEK pAb (ATL-HPA057799) | |
| Datasheet | Anti DEK pAb (ATL-HPA057799) Datasheet (External Link) |
| Vendor Page | Anti DEK pAb (ATL-HPA057799) at Atlas |
| Documents & Links for Anti DEK pAb (ATL-HPA057799) | |
| Datasheet | Anti DEK pAb (ATL-HPA057799) Datasheet (External Link) |
| Vendor Page | Anti DEK pAb (ATL-HPA057799) |