Anti DEFB136 pAb (ATL-HPA068255)

Atlas Antibodies

Catalog No: ATL-HPA068255-25

• 

Product Description

Protein Description: defensin beta 136
Gene Name: DEFB136
Alternative Gene Name: DEFB137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054763: 47%, ENSRNOG00000038757: 47%
Entrez Gene ID: 613210
Uniprot ID: Q30KP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP
• Gene Sequence: GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP
• Gene ID - Mouse: ENSMUSG00000054763
• Gene ID - Rat: ENSRNOG00000038757
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.