Protein Description: death effector domain containing
Gene Name: DEDD
Alternative Gene Name: CASP8IP1, DEDD1, DEFT, FLDED1, KE05
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013973: 98%, ENSRNOG00000003779: 98%
Entrez Gene ID: 9191
Uniprot ID: O75618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DEDD
Alternative Gene Name: CASP8IP1, DEDD1, DEFT, FLDED1, KE05
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013973: 98%, ENSRNOG00000003779: 98%
Entrez Gene ID: 9191
Uniprot ID: O75618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSD |
| Documents & Links for Anti DEDD pAb (ATL-HPA073628) | |
| Datasheet | Anti DEDD pAb (ATL-HPA073628) Datasheet (External Link) |
| Vendor Page | Anti DEDD pAb (ATL-HPA073628) at Atlas |
| Documents & Links for Anti DEDD pAb (ATL-HPA073628) | |
| Datasheet | Anti DEDD pAb (ATL-HPA073628) Datasheet (External Link) |
| Vendor Page | Anti DEDD pAb (ATL-HPA073628) |