Anti DEDD pAb (ATL-HPA073628)

Atlas Antibodies

Catalog No: ATL-HPA073628-25

• 

Product Description

Protein Description: death effector domain containing
Gene Name: DEDD
Alternative Gene Name: CASP8IP1, DEDD1, DEFT, FLDED1, KE05
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013973: 98%, ENSRNOG00000003779: 98%
Entrez Gene ID: 9191
Uniprot ID: O75618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSD
• Gene Sequence: LALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSD
• Gene ID - Mouse: ENSMUSG00000013973
• Gene ID - Rat: ENSRNOG00000003779
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.