Protein Description: 2,4-dienoyl CoA reductase 1, mitochondrial
Gene Name: DECR1
Alternative Gene Name: DECR, SDR18C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028223: 90%, ENSRNOG00000008236: 90%
Entrez Gene ID: 1666
Uniprot ID: Q16698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DECR1
Alternative Gene Name: DECR, SDR18C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028223: 90%, ENSRNOG00000008236: 90%
Entrez Gene ID: 1666
Uniprot ID: Q16698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDP |
Documents & Links for Anti DECR1 pAb (ATL-HPA023160 w/enhanced validation) | |
Datasheet | Anti DECR1 pAb (ATL-HPA023160 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DECR1 pAb (ATL-HPA023160 w/enhanced validation) at Atlas |
Documents & Links for Anti DECR1 pAb (ATL-HPA023160 w/enhanced validation) | |
Datasheet | Anti DECR1 pAb (ATL-HPA023160 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DECR1 pAb (ATL-HPA023160 w/enhanced validation) |