Description
Product Description
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Gene Name: DDX54
Alternative Gene Name: APR-5, DP97, MGC2835
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029599: 76%, ENSRNOG00000001377: 78%
Entrez Gene ID: 79039
Uniprot ID: Q8TDD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DDX54
Alternative Gene Name: APR-5, DP97, MGC2835
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029599: 76%, ENSRNOG00000001377: 78%
Entrez Gene ID: 79039
Uniprot ID: Q8TDD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TAYSLVAPDEIPYLLDLHLFLGRSLTLARPLKEPSGVAGVDGMLGRVPQSVVDEEDSGLQSTLEASLELRGLARVADNAQQQYV |
Gene Sequence | TAYSLVAPDEIPYLLDLHLFLGRSLTLARPLKEPSGVAGVDGMLGRVPQSVVDEEDSGLQSTLEASLELRGLARVADNAQQQYV |
Gene ID - Mouse | ENSMUSG00000029599 |
Gene ID - Rat | ENSRNOG00000001377 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DDX54 pAb (ATL-HPA070786) | |
Datasheet | Anti DDX54 pAb (ATL-HPA070786) Datasheet (External Link) |
Vendor Page | Anti DDX54 pAb (ATL-HPA070786) at Atlas Antibodies |
Documents & Links for Anti DDX54 pAb (ATL-HPA070786) | |
Datasheet | Anti DDX54 pAb (ATL-HPA070786) Datasheet (External Link) |
Vendor Page | Anti DDX54 pAb (ATL-HPA070786) |