Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 17
Gene Name: DDX17
Alternative Gene Name: P72
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055065: 96%, ENSRNOG00000051170: 96%
Entrez Gene ID: 10521
Uniprot ID: Q92841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DDX17
Alternative Gene Name: P72
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055065: 96%, ENSRNOG00000051170: 96%
Entrez Gene ID: 10521
Uniprot ID: Q92841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ |
Documents & Links for Anti DDX17 pAb (ATL-HPA063142) | |
Datasheet | Anti DDX17 pAb (ATL-HPA063142) Datasheet (External Link) |
Vendor Page | Anti DDX17 pAb (ATL-HPA063142) at Atlas |
Documents & Links for Anti DDX17 pAb (ATL-HPA063142) | |
Datasheet | Anti DDX17 pAb (ATL-HPA063142) Datasheet (External Link) |
Vendor Page | Anti DDX17 pAb (ATL-HPA063142) |