Protein Description: DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11
Gene Name: DDX11
Alternative Gene Name: CHL1, CHLR1, KRG2, WABS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035842: 64%, ENSRNOG00000023803: 31%
Entrez Gene ID: 1663
Uniprot ID: Q96FC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DDX11
Alternative Gene Name: CHL1, CHLR1, KRG2, WABS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035842: 64%, ENSRNOG00000023803: 31%
Entrez Gene ID: 1663
Uniprot ID: Q96FC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV |
Documents & Links for Anti DDX11 pAb (ATL-HPA065197) | |
Datasheet | Anti DDX11 pAb (ATL-HPA065197) Datasheet (External Link) |
Vendor Page | Anti DDX11 pAb (ATL-HPA065197) at Atlas |
Documents & Links for Anti DDX11 pAb (ATL-HPA065197) | |
Datasheet | Anti DDX11 pAb (ATL-HPA065197) Datasheet (External Link) |
Vendor Page | Anti DDX11 pAb (ATL-HPA065197) |