Description
Product Description
Protein Description: discoidin domain receptor tyrosine kinase 2
Gene Name: DDR2
Alternative Gene Name: NTRKR3, TKT, TYRO10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026674: 96%, ENSRNOG00000002881: 93%
Entrez Gene ID: 4921
Uniprot ID: Q16832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DDR2
Alternative Gene Name: NTRKR3, TKT, TYRO10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026674: 96%, ENSRNOG00000002881: 93%
Entrez Gene ID: 4921
Uniprot ID: Q16832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ |
Gene Sequence | FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ |
Gene ID - Mouse | ENSMUSG00000026674 |
Gene ID - Rat | ENSRNOG00000002881 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DDR2 pAb (ATL-HPA070112) | |
Datasheet | Anti DDR2 pAb (ATL-HPA070112) Datasheet (External Link) |
Vendor Page | Anti DDR2 pAb (ATL-HPA070112) at Atlas Antibodies |
Documents & Links for Anti DDR2 pAb (ATL-HPA070112) | |
Datasheet | Anti DDR2 pAb (ATL-HPA070112) Datasheet (External Link) |
Vendor Page | Anti DDR2 pAb (ATL-HPA070112) |