Protein Description: discoidin domain receptor tyrosine kinase 2
Gene Name: DDR2
Alternative Gene Name: NTRKR3, TKT, TYRO10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026674: 96%, ENSRNOG00000002881: 93%
Entrez Gene ID: 4921
Uniprot ID: Q16832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DDR2
Alternative Gene Name: NTRKR3, TKT, TYRO10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026674: 96%, ENSRNOG00000002881: 93%
Entrez Gene ID: 4921
Uniprot ID: Q16832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ |
| Documents & Links for Anti DDR2 pAb (ATL-HPA070112) | |
| Datasheet | Anti DDR2 pAb (ATL-HPA070112) Datasheet (External Link) |
| Vendor Page | Anti DDR2 pAb (ATL-HPA070112) at Atlas |
| Documents & Links for Anti DDR2 pAb (ATL-HPA070112) | |
| Datasheet | Anti DDR2 pAb (ATL-HPA070112) Datasheet (External Link) |
| Vendor Page | Anti DDR2 pAb (ATL-HPA070112) |