Anti DDR2 pAb (ATL-HPA070112)

Atlas Antibodies

Catalog No: ATL-HPA070112-25

• 

Product Description

Protein Description: discoidin domain receptor tyrosine kinase 2
Gene Name: DDR2
Alternative Gene Name: NTRKR3, TKT, TYRO10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026674: 96%, ENSRNOG00000002881: 93%
Entrez Gene ID: 4921
Uniprot ID: Q16832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ
• Gene Sequence: FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ
• Gene ID - Mouse: ENSMUSG00000026674
• Gene ID - Rat: ENSRNOG00000002881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.