Description
Product Description
Protein Description: DNA-damage-inducible transcript 3
Gene Name: DDIT3
Alternative Gene Name: CHOP, CHOP10, GADD153
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025408: 84%, ENSRNOG00000006789: 88%
Entrez Gene ID: 1649
Uniprot ID: P35638
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DDIT3
Alternative Gene Name: CHOP, CHOP10, GADD153
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025408: 84%, ENSRNOG00000006789: 88%
Entrez Gene ID: 1649
Uniprot ID: P35638
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ |
Gene Sequence | AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ |
Gene ID - Mouse | ENSMUSG00000025408 |
Gene ID - Rat | ENSRNOG00000006789 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DDIT3 pAb (ATL-HPA058416) | |
Datasheet | Anti DDIT3 pAb (ATL-HPA058416) Datasheet (External Link) |
Vendor Page | Anti DDIT3 pAb (ATL-HPA058416) at Atlas Antibodies |
Documents & Links for Anti DDIT3 pAb (ATL-HPA058416) | |
Datasheet | Anti DDIT3 pAb (ATL-HPA058416) Datasheet (External Link) |
Vendor Page | Anti DDIT3 pAb (ATL-HPA058416) |