Protein Description: DDHD domain containing 2
Gene Name: DDHD2
Alternative Gene Name: KIAA0725, SAMWD1, SPG54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061313: 87%, ENSRNOG00000015501: 88%
Entrez Gene ID: 23259
Uniprot ID: O94830
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DDHD2
Alternative Gene Name: KIAA0725, SAMWD1, SPG54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061313: 87%, ENSRNOG00000015501: 88%
Entrez Gene ID: 23259
Uniprot ID: O94830
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RMHLELREGLTRMSMDLKNNLLGSLRMAWKSFTRAPYPALQASETPEETEAEPESTSEKPSDVNTEETSVAVKEEVLPINVGMLNGGQRIDYVLQEK |
Documents & Links for Anti DDHD2 pAb (ATL-HPA023147) | |
Datasheet | Anti DDHD2 pAb (ATL-HPA023147) Datasheet (External Link) |
Vendor Page | Anti DDHD2 pAb (ATL-HPA023147) at Atlas |
Documents & Links for Anti DDHD2 pAb (ATL-HPA023147) | |
Datasheet | Anti DDHD2 pAb (ATL-HPA023147) Datasheet (External Link) |
Vendor Page | Anti DDHD2 pAb (ATL-HPA023147) |