Protein Description: damage-specific DNA binding protein 1, 127kDa
Gene Name: DDB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024740: 100%, ENSRNOG00000020715: 99%
Entrez Gene ID: 1642
Uniprot ID: Q16531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DDB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024740: 100%, ENSRNOG00000020715: 99%
Entrez Gene ID: 1642
Uniprot ID: Q16531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA |
Documents & Links for Anti DDB1 pAb (ATL-HPA068456) | |
Datasheet | Anti DDB1 pAb (ATL-HPA068456) Datasheet (External Link) |
Vendor Page | Anti DDB1 pAb (ATL-HPA068456) at Atlas |
Documents & Links for Anti DDB1 pAb (ATL-HPA068456) | |
Datasheet | Anti DDB1 pAb (ATL-HPA068456) Datasheet (External Link) |
Vendor Page | Anti DDB1 pAb (ATL-HPA068456) |