Anti DDB1 pAb (ATL-HPA068456)

Atlas Antibodies

Catalog No: ATL-HPA068456-25

• 

Product Description

Protein Description: damage-specific DNA binding protein 1, 127kDa
Gene Name: DDB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024740: 100%, ENSRNOG00000020715: 99%
Entrez Gene ID: 1642
Uniprot ID: Q16531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA
• Gene Sequence: LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA
• Gene ID - Mouse: ENSMUSG00000024740
• Gene ID - Rat: ENSRNOG00000020715
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.