Description
Product Description
Protein Description: dicarbonyl/L-xylulose reductase
Gene Name: DCXR
Alternative Gene Name: DCR, KIDCR, SDR20C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039450: 84%, ENSRNOG00000050315: 82%
Entrez Gene ID: 51181
Uniprot ID: Q7Z4W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DCXR
Alternative Gene Name: DCR, KIDCR, SDR20C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039450: 84%, ENSRNOG00000050315: 82%
Entrez Gene ID: 51181
Uniprot ID: Q7Z4W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG |
Gene Sequence | IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG |
Gene ID - Mouse | ENSMUSG00000039450 |
Gene ID - Rat | ENSRNOG00000050315 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) | |
Datasheet | Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) | |
Datasheet | Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) |
Citations
Citations for Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) – 1 Found |
Hubbs, Ann F; Cumpston, Amy M; Goldsmith, W Travis; Battelli, Lori A; Kashon, Michael L; Jackson, Mark C; Frazer, David G; Fedan, Jeffrey S; Goravanahally, Madhusudan P; Castranova, Vincent; Kreiss, Kathleen; Willard, Patsy A; Friend, Sherri; Schwegler-Berry, Diane; Fluharty, Kara L; Sriram, Krishnan. Respiratory and olfactory cytotoxicity of inhaled 2,3-pentanedione in Sprague-Dawley rats. The American Journal Of Pathology. 2012;181(3):829-44. PubMed |