Protein Description: doublecortin
Gene Name: DCX
Alternative Gene Name: DBCN, DC, LISX, SCLH, XLIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031285: 99%, ENSRNOG00000047712: 94%
Entrez Gene ID: 1641
Uniprot ID: O43602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DCX
Alternative Gene Name: DBCN, DC, LISX, SCLH, XLIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031285: 99%, ENSRNOG00000047712: 94%
Entrez Gene ID: 1641
Uniprot ID: O43602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTS |
| Documents & Links for Anti DCX pAb (ATL-HPA036121) | |
| Datasheet | Anti DCX pAb (ATL-HPA036121) Datasheet (External Link) |
| Vendor Page | Anti DCX pAb (ATL-HPA036121) at Atlas |
| Documents & Links for Anti DCX pAb (ATL-HPA036121) | |
| Datasheet | Anti DCX pAb (ATL-HPA036121) Datasheet (External Link) |
| Vendor Page | Anti DCX pAb (ATL-HPA036121) |