Anti DCTN5 pAb (ATL-HPA063710)

Atlas Antibodies

Catalog No: ATL-HPA063710-25

• 
• 

Product Description

Protein Description: dynactin 5 (p25)
Gene Name: DCTN5
Alternative Gene Name: MGC3248, p25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030868: 100%, ENSRNOG00000018048: 100%
Entrez Gene ID: 84516
Uniprot ID: Q9BTE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKF
• Gene Sequence: VFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKF
• Gene ID - Mouse: ENSMUSG00000030868
• Gene ID - Rat: ENSRNOG00000018048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.