Description
Product Description
Protein Description: dynactin 5 (p25)
Gene Name: DCTN5
Alternative Gene Name: MGC3248, p25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030868: 100%, ENSRNOG00000018048: 100%
Entrez Gene ID: 84516
Uniprot ID: Q9BTE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DCTN5
Alternative Gene Name: MGC3248, p25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030868: 100%, ENSRNOG00000018048: 100%
Entrez Gene ID: 84516
Uniprot ID: Q9BTE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKF |
Gene Sequence | VFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKF |
Gene ID - Mouse | ENSMUSG00000030868 |
Gene ID - Rat | ENSRNOG00000018048 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DCTN5 pAb (ATL-HPA063710) | |
Datasheet | Anti DCTN5 pAb (ATL-HPA063710) Datasheet (External Link) |
Vendor Page | Anti DCTN5 pAb (ATL-HPA063710) at Atlas Antibodies |
Documents & Links for Anti DCTN5 pAb (ATL-HPA063710) | |
Datasheet | Anti DCTN5 pAb (ATL-HPA063710) Datasheet (External Link) |
Vendor Page | Anti DCTN5 pAb (ATL-HPA063710) |