Protein Description: dynactin subunit 1
Gene Name: DCTN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031865: 95%, ENSRNOG00000010048: 95%
Entrez Gene ID: 1639
Uniprot ID: Q14203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DCTN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031865: 95%, ENSRNOG00000010048: 95%
Entrez Gene ID: 1639
Uniprot ID: Q14203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATV |
| Documents & Links for Anti DCTN1 pAb (ATL-HPA071875) | |
| Datasheet | Anti DCTN1 pAb (ATL-HPA071875) Datasheet (External Link) |
| Vendor Page | Anti DCTN1 pAb (ATL-HPA071875) at Atlas |
| Documents & Links for Anti DCTN1 pAb (ATL-HPA071875) | |
| Datasheet | Anti DCTN1 pAb (ATL-HPA071875) Datasheet (External Link) |
| Vendor Page | Anti DCTN1 pAb (ATL-HPA071875) |