Description
Product Description
Protein Description: dynactin subunit 1
Gene Name: DCTN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031865: 95%, ENSRNOG00000010048: 95%
Entrez Gene ID: 1639
Uniprot ID: Q14203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DCTN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031865: 95%, ENSRNOG00000010048: 95%
Entrez Gene ID: 1639
Uniprot ID: Q14203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATV |
Gene Sequence | ALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATV |
Gene ID - Mouse | ENSMUSG00000031865 |
Gene ID - Rat | ENSRNOG00000010048 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DCTN1 pAb (ATL-HPA071875) | |
Datasheet | Anti DCTN1 pAb (ATL-HPA071875) Datasheet (External Link) |
Vendor Page | Anti DCTN1 pAb (ATL-HPA071875) at Atlas Antibodies |
Documents & Links for Anti DCTN1 pAb (ATL-HPA071875) | |
Datasheet | Anti DCTN1 pAb (ATL-HPA071875) Datasheet (External Link) |
Vendor Page | Anti DCTN1 pAb (ATL-HPA071875) |