Anti DCLRE1C pAb (ATL-HPA069295)

Catalog No:
ATL-HPA069295-25
$447.00

Description

Product Description

Protein Description: DNA cross-link repair 1C
Gene Name: DCLRE1C
Alternative Gene Name: A-SCID, ARTEMIS, FLJ11360, SCIDA, SNM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026648: 57%, ENSRNOG00000015980: 57%
Entrez Gene ID: 64421
Uniprot ID: Q96SD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS
Gene Sequence WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS
Gene ID - Mouse ENSMUSG00000026648
Gene ID - Rat ENSRNOG00000015980
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DCLRE1C pAb (ATL-HPA069295)
Datasheet Anti DCLRE1C pAb (ATL-HPA069295) Datasheet (External Link)
Vendor Page Anti DCLRE1C pAb (ATL-HPA069295) at Atlas Antibodies

Documents & Links for Anti DCLRE1C pAb (ATL-HPA069295)
Datasheet Anti DCLRE1C pAb (ATL-HPA069295) Datasheet (External Link)
Vendor Page Anti DCLRE1C pAb (ATL-HPA069295)

Product Description

Protein Description: DNA cross-link repair 1C
Gene Name: DCLRE1C
Alternative Gene Name: A-SCID, ARTEMIS, FLJ11360, SCIDA, SNM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026648: 57%, ENSRNOG00000015980: 57%
Entrez Gene ID: 64421
Uniprot ID: Q96SD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS
Gene Sequence WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS
Gene ID - Mouse ENSMUSG00000026648
Gene ID - Rat ENSRNOG00000015980
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DCLRE1C pAb (ATL-HPA069295)
Datasheet Anti DCLRE1C pAb (ATL-HPA069295) Datasheet (External Link)
Vendor Page Anti DCLRE1C pAb (ATL-HPA069295) at Atlas Antibodies

Documents & Links for Anti DCLRE1C pAb (ATL-HPA069295)
Datasheet Anti DCLRE1C pAb (ATL-HPA069295) Datasheet (External Link)
Vendor Page Anti DCLRE1C pAb (ATL-HPA069295)