Description
Product Description
Protein Description: DNA cross-link repair 1C
Gene Name: DCLRE1C
Alternative Gene Name: A-SCID, ARTEMIS, FLJ11360, SCIDA, SNM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026648: 57%, ENSRNOG00000015980: 57%
Entrez Gene ID: 64421
Uniprot ID: Q96SD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DCLRE1C
Alternative Gene Name: A-SCID, ARTEMIS, FLJ11360, SCIDA, SNM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026648: 57%, ENSRNOG00000015980: 57%
Entrez Gene ID: 64421
Uniprot ID: Q96SD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS |
Gene Sequence | WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS |
Gene ID - Mouse | ENSMUSG00000026648 |
Gene ID - Rat | ENSRNOG00000015980 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DCLRE1C pAb (ATL-HPA069295) | |
Datasheet | Anti DCLRE1C pAb (ATL-HPA069295) Datasheet (External Link) |
Vendor Page | Anti DCLRE1C pAb (ATL-HPA069295) at Atlas Antibodies |
Documents & Links for Anti DCLRE1C pAb (ATL-HPA069295) | |
Datasheet | Anti DCLRE1C pAb (ATL-HPA069295) Datasheet (External Link) |
Vendor Page | Anti DCLRE1C pAb (ATL-HPA069295) |