Protein Description: DNA cross-link repair 1B
Gene Name: DCLRE1B
Alternative Gene Name: FLJ12810, FLJ13998, SNM1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027845: 71%, ENSRNOG00000019367: 71%
Entrez Gene ID: 64858
Uniprot ID: Q9H816
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DCLRE1B
Alternative Gene Name: FLJ12810, FLJ13998, SNM1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027845: 71%, ENSRNOG00000019367: 71%
Entrez Gene ID: 64858
Uniprot ID: Q9H816
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQ |
| Documents & Links for Anti DCLRE1B pAb (ATL-HPA064934) | |
| Datasheet | Anti DCLRE1B pAb (ATL-HPA064934) Datasheet (External Link) |
| Vendor Page | Anti DCLRE1B pAb (ATL-HPA064934) at Atlas |
| Documents & Links for Anti DCLRE1B pAb (ATL-HPA064934) | |
| Datasheet | Anti DCLRE1B pAb (ATL-HPA064934) Datasheet (External Link) |
| Vendor Page | Anti DCLRE1B pAb (ATL-HPA064934) |