Anti DBX2 pAb (ATL-HPA066053)

Atlas Antibodies

Catalog No: ATL-HPA066053-25

• 

Product Description

Protein Description: developing brain homeobox 2
Gene Name: DBX2
Alternative Gene Name: FLJ16139
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045608: 49%, ENSRNOG00000006885: 53%
Entrez Gene ID: 440097
Uniprot ID: Q6ZNG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTG
• Gene Sequence: SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTG
• Gene ID - Mouse: ENSMUSG00000045608
• Gene ID - Rat: ENSRNOG00000006885
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.