Protein Description: developing brain homeobox 2
Gene Name: DBX2
Alternative Gene Name: FLJ16139
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045608: 49%, ENSRNOG00000006885: 53%
Entrez Gene ID: 440097
Uniprot ID: Q6ZNG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DBX2
Alternative Gene Name: FLJ16139
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045608: 49%, ENSRNOG00000006885: 53%
Entrez Gene ID: 440097
Uniprot ID: Q6ZNG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTG |
Documents & Links for Anti DBX2 pAb (ATL-HPA066053) | |
Datasheet | Anti DBX2 pAb (ATL-HPA066053) Datasheet (External Link) |
Vendor Page | Anti DBX2 pAb (ATL-HPA066053) at Atlas |
Documents & Links for Anti DBX2 pAb (ATL-HPA066053) | |
Datasheet | Anti DBX2 pAb (ATL-HPA066053) Datasheet (External Link) |
Vendor Page | Anti DBX2 pAb (ATL-HPA066053) |