Protein Description: dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Gene Name: DBH
Alternative Gene Name: DBM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000889: 80%, ENSRNOG00000006641: 75%
Entrez Gene ID: 1621
Uniprot ID: P09172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DBH
Alternative Gene Name: DBM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000889: 80%, ENSRNOG00000006641: 75%
Entrez Gene ID: 1621
Uniprot ID: P09172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ |
| Documents & Links for Anti DBH pAb (ATL-HPA070789 w/enhanced validation) | |
| Datasheet | Anti DBH pAb (ATL-HPA070789 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DBH pAb (ATL-HPA070789 w/enhanced validation) at Atlas |
| Documents & Links for Anti DBH pAb (ATL-HPA070789 w/enhanced validation) | |
| Datasheet | Anti DBH pAb (ATL-HPA070789 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DBH pAb (ATL-HPA070789 w/enhanced validation) |