Description
Product Description
Protein Description: death-domain associated protein
Gene Name: DAXX
Alternative Gene Name: DAP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002307: 76%, ENSRNOG00000000477: 78%
Entrez Gene ID: 1616
Uniprot ID: Q9UER7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DAXX
Alternative Gene Name: DAP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002307: 76%, ENSRNOG00000000477: 78%
Entrez Gene ID: 1616
Uniprot ID: Q9UER7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR |
Gene Sequence | ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR |
Gene ID - Mouse | ENSMUSG00000002307 |
Gene ID - Rat | ENSRNOG00000000477 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DAXX pAb (ATL-HPA065779) | |
Datasheet | Anti DAXX pAb (ATL-HPA065779) Datasheet (External Link) |
Vendor Page | Anti DAXX pAb (ATL-HPA065779) at Atlas Antibodies |
Documents & Links for Anti DAXX pAb (ATL-HPA065779) | |
Datasheet | Anti DAXX pAb (ATL-HPA065779) Datasheet (External Link) |
Vendor Page | Anti DAXX pAb (ATL-HPA065779) |