Anti DAXX pAb (ATL-HPA065779)

Catalog No:
ATL-HPA065779-25
$395.00

Description

Product Description

Protein Description: death-domain associated protein
Gene Name: DAXX
Alternative Gene Name: DAP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002307: 76%, ENSRNOG00000000477: 78%
Entrez Gene ID: 1616
Uniprot ID: Q9UER7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR
Gene Sequence ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR
Gene ID - Mouse ENSMUSG00000002307
Gene ID - Rat ENSRNOG00000000477
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DAXX pAb (ATL-HPA065779)
Datasheet Anti DAXX pAb (ATL-HPA065779) Datasheet (External Link)
Vendor Page Anti DAXX pAb (ATL-HPA065779) at Atlas Antibodies

Documents & Links for Anti DAXX pAb (ATL-HPA065779)
Datasheet Anti DAXX pAb (ATL-HPA065779) Datasheet (External Link)
Vendor Page Anti DAXX pAb (ATL-HPA065779)

Product Description

Protein Description: death-domain associated protein
Gene Name: DAXX
Alternative Gene Name: DAP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002307: 76%, ENSRNOG00000000477: 78%
Entrez Gene ID: 1616
Uniprot ID: Q9UER7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR
Gene Sequence ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR
Gene ID - Mouse ENSMUSG00000002307
Gene ID - Rat ENSRNOG00000000477
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DAXX pAb (ATL-HPA065779)
Datasheet Anti DAXX pAb (ATL-HPA065779) Datasheet (External Link)
Vendor Page Anti DAXX pAb (ATL-HPA065779) at Atlas Antibodies

Documents & Links for Anti DAXX pAb (ATL-HPA065779)
Datasheet Anti DAXX pAb (ATL-HPA065779) Datasheet (External Link)
Vendor Page Anti DAXX pAb (ATL-HPA065779)