Protein Description: death-associated protein kinase 3
Gene Name: DAPK3
Alternative Gene Name: ZIP, ZIPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034974: 67%, ENSRNOG00000020383: 67%
Entrez Gene ID: 1613
Uniprot ID: O43293
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DAPK3
Alternative Gene Name: ZIP, ZIPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034974: 67%, ENSRNOG00000020383: 67%
Entrez Gene ID: 1613
Uniprot ID: O43293
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DPKRRMTIAQSLEHSWIKAIRRRNVRGEDS |
Documents & Links for Anti DAPK3 pAb (ATL-HPA064809) | |
Datasheet | Anti DAPK3 pAb (ATL-HPA064809) Datasheet (External Link) |
Vendor Page | Anti DAPK3 pAb (ATL-HPA064809) at Atlas |
Documents & Links for Anti DAPK3 pAb (ATL-HPA064809) | |
Datasheet | Anti DAPK3 pAb (ATL-HPA064809) Datasheet (External Link) |
Vendor Page | Anti DAPK3 pAb (ATL-HPA064809) |