Anti DAGLB pAb (ATL-HPA069377)

Atlas Antibodies

Catalog No: ATL-HPA069377-25

• 
• 

Product Description

Protein Description: diacylglycerol lipase, beta
Gene Name: DAGLB
Alternative Gene Name: DAGLBETA, KCCR13L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039206: 78%, ENSRNOG00000001079: 80%
Entrez Gene ID: 221955
Uniprot ID: Q8NCG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLINDGILSQAFSIA
• Gene Sequence: LVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLINDGILSQAFSIA
• Gene ID - Mouse: ENSMUSG00000039206
• Gene ID - Rat: ENSRNOG00000001079
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.