Anti DAGLA pAb (ATL-HPA062497)

Atlas Antibodies

Catalog No: ATL-HPA062497-25

• 

Product Description

Protein Description: diacylglycerol lipase, alpha
Gene Name: DAGLA
Alternative Gene Name: C11orf11, DAGLALPHA, KIAA0659, NSDDR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035735: 100%, ENSRNOG00000027264: 100%
Entrez Gene ID: 747
Uniprot ID: Q9Y4D2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL
• Gene Sequence: QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL
• Gene ID - Mouse: ENSMUSG00000035735
• Gene ID - Rat: ENSRNOG00000027264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti DAGLA pAb (ATL-HPA062497) – 2 Found

Veres, Adrian; Faust, Aubrey L; Bushnell, Henry L; Engquist, Elise N; Kenty, Jennifer Hyoje-Ryu; Harb, George; Poh, Yeh-Chuin; Sintov, Elad; Gürtler, Mads; Pagliuca, Felicia W; Peterson, Quinn P; Melton, Douglas A. Charting cellular identity during human in vitro β-cell differentiation. Nature. 2019;569(7756):368-373. 

Nielsen, John E; Rolland, Antoine D; Rajpert-De Meyts, Ewa; Janfelt, Christian; Jørgensen, Anne; Winge, Sofia B; Kristensen, David M; Juul, Anders; Chalmel, Frédéric; Jégou, Bernard; Skakkebaek, Niels E. Characterisation and localisation of the endocannabinoid system components in the adult human testis. Scientific Reports. 2019;9(1):12866.