Description
Product Description
Protein Description: dishevelled binding antagonist of beta catenin 1
Gene Name: DACT1
Alternative Gene Name: DAPPER, DAPPER1, FRODO, HDPR1, THYEX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044548: 89%, ENSRNOG00000008445: 88%
Entrez Gene ID: 51339
Uniprot ID: Q9NYF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DACT1
Alternative Gene Name: DAPPER, DAPPER1, FRODO, HDPR1, THYEX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044548: 89%, ENSRNOG00000008445: 88%
Entrez Gene ID: 51339
Uniprot ID: Q9NYF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VFSECLSSCHSSTCFCSPLEATLSLSDGCPKSADLIGLLEYKEGHCEDQASGAVCRSLSTPQFNSLDVIADVNPKYQCDLVSKNGNDVYRYP |
Gene Sequence | VFSECLSSCHSSTCFCSPLEATLSLSDGCPKSADLIGLLEYKEGHCEDQASGAVCRSLSTPQFNSLDVIADVNPKYQCDLVSKNGNDVYRYP |
Gene ID - Mouse | ENSMUSG00000044548 |
Gene ID - Rat | ENSRNOG00000008445 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti DACT1 pAb (ATL-HPA074619) | |
Datasheet | Anti DACT1 pAb (ATL-HPA074619) Datasheet (External Link) |
Vendor Page | Anti DACT1 pAb (ATL-HPA074619) at Atlas Antibodies |
Documents & Links for Anti DACT1 pAb (ATL-HPA074619) | |
Datasheet | Anti DACT1 pAb (ATL-HPA074619) Datasheet (External Link) |
Vendor Page | Anti DACT1 pAb (ATL-HPA074619) |