Protein Description: dishevelled associated activator of morphogenesis 1
Gene Name: DAAM1
Alternative Gene Name: KIAA0666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034574: 100%, ENSRNOG00000004345: 100%
Entrez Gene ID: 23002
Uniprot ID: Q9Y4D1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DAAM1
Alternative Gene Name: KIAA0666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034574: 100%, ENSRNOG00000004345: 100%
Entrez Gene ID: 23002
Uniprot ID: Q9Y4D1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | APRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSE |
| Documents & Links for Anti DAAM1 pAb (ATL-HPA064789) | |
| Datasheet | Anti DAAM1 pAb (ATL-HPA064789) Datasheet (External Link) |
| Vendor Page | Anti DAAM1 pAb (ATL-HPA064789) at Atlas |
| Documents & Links for Anti DAAM1 pAb (ATL-HPA064789) | |
| Datasheet | Anti DAAM1 pAb (ATL-HPA064789) Datasheet (External Link) |
| Vendor Page | Anti DAAM1 pAb (ATL-HPA064789) |